ATP-dependent Clp protease proteolytic subunit
Target information
- CovInDB Protein
- Q2G036
- Name
- ATP-dependent Clp protease proteolytic subunit
- Encoding Gene
- clpP
- Synonyms
-
- Endopeptidase Clp
- Taxonomy
- Staphylococcus aureus (strain NCTC 8325 / PS 47)
- Description
-
Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
- Sequence
-
MNLIPTVIETTNRGERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPETK
- Active Site
-
Feature Key Position(s) Description Active site 123 None Active site 98 Nucleophile - Structure
-
Check covalent ligand-protein complexes.
PDB: 6N80
Show SurfaceSite View - Reference
- UniProt
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|