Cathepsin K
Target information
- CovInDB Protein
- P43235
- Name
- Cathepsin K
- Encoding Gene
- CTSK
- Synonyms
-
- Cathepsin O
- Cathepsin O2
- Cathepsin X
- Taxonomy
- Homo sapiens (Human)
- Description
-
Thiol protease involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Involved in the release of thyroid hormone thyroxine (T4) by limited proteolysis of TG/thyroglobulin in the thyroid follicle lumen (PubMed:Sequence
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
- Active Site
Feature Key Position(s) Description Active site 139 None Active site 276 None Active site 296 None - Structure
Check covalent ligand-protein complexes.
PDB: 1MEM
Show SurfaceSite View- Reference
- UniProt
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|