Neutrophil elastase
Target information
- CovInDB Protein
- P08246
- Name
- Neutrophil elastase
- Encoding Gene
- ELANE
- Synonyms
-
- Bone marrow serine protease
- Elastase-2
- Human leukocyte elastase
- HLE
- Medullasin
- PMN elastase
- Taxonomy
- Homo sapiens (Human)
- Description
-
Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis (PubMed:15140022). Capable of killing E.coli but not S.aureus in vitro; digests outer membrane protein A (ompA) in E.coli and K.pneumoniae (PubMed:10947984).
- Sequence
-
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
- Active Site
-
Feature Key Position(s) Description Active site 117 Charge relay system Active site 202 Charge relay system Active site 70 Charge relay system - Structure
-
Check covalent ligand-protein complexes.
PDB: 1H1B
Show SurfaceSite View - Reference
- UniProt
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|