Bcl-2-related protein A1
Target information
- CovInDB Protein
- Q16548
- Name
- Bcl-2-related protein A1
- Encoding Gene
- BCL2A1
- Synonyms
-
- Bcl-2-like protein 5
- Bcl2-L-5
- Hemopoietic-specific early response protein
- Protein BFL-1
- Protein GRS
- Taxonomy
- Homo sapiens (Human)
- Description
-
Retards apoptosis induced by IL-3 deprivation. May function in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection (By similarity). Can inhibit apoptosis induced by serum starvation in the mammary epithelial cell line HC11 (By similarity).
- Sequence
-
MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
- Active Site
-
Feature Key Position(s) Description None None None - Structure
- Not Available
- Reference
- UniProt
Check covalent ligand-protein complexes.
Covalent Inhibitors
| Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
|---|