Beta-lactamase TEM
Target information
- CovInDB Protein
- P62593
- Name
- Beta-lactamase TEM
- Encoding Gene
- bla
- Synonyms
-
- IRT-4
- Penicillinase
- TEM-1
- TEM-16/CAZ-7
- TEM-2
- TEM-24/CAZ-6
- TEM-3
- TEM-4
- TEM-5
- TEM-6
- TEM-8/CAZ-2
- Taxonomy
- Escherichia coli
- Description
-
TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.
- Sequence
-
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
- Active Site
-
Feature Key Position(s) Description Active site 166 Proton acceptor Active site 68 Acyl-ester intermediate - Structure
-
PDB:  1ERQ
Show SurfaceSite View - Reference
- UniProt
Covalent Inhibitors
Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
---|