Beta-lactamase TEM

Target information

CovInDB Protein
P62593
Name
Beta-lactamase TEM
Encoding Gene
bla
Synonyms
  • IRT-4
  • Penicillinase
  • TEM-1
  • TEM-16/CAZ-7
  • TEM-2
  • TEM-24/CAZ-6
  • TEM-3
  • TEM-4
  • TEM-5
  • TEM-6
  • TEM-8/CAZ-2
Taxonomy
Escherichia coli
Description

TEM-type are the most prevalent beta-lactamases in enterobacteria; they hydrolyze the beta-lactam bond in susceptible beta-lactam antibiotics, thus conferring resistance to penicillins and cephalosporins. TEM-3 and TEM-4 are capable of hydrolyzing cefotaxime and ceftazidime. TEM-5 is capable of hydrolyzing ceftazidime. TEM-6 is capable of hydrolyzing ceftazidime and aztreonam. TEM-8/CAZ-2, TEM-16/CAZ-7 and TEM-24/CAZ-6 are markedly active against ceftazidime. IRT-4 shows resistance to beta-lactamase inhibitors.

Sequence

MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW

Active Site
Feature Key Position(s) Description
Active site 166 Proton acceptor
Active site 68 Acyl-ester intermediate
Structure

PDB:  1ERQ

Show Surface
Site View
Reference
UniProt



Covalent Inhibitors

  Download

Structure Rank ID Warhead Reaction Mechanism Target Site Activity Type Relation Value Unit Experiment Method Assay Reference