Prostaglandin E synthase
Target information
- CovInDB Protein
- O14684
- Name
- Prostaglandin E synthase
- Encoding Gene
- PTGES
- Synonyms
-
- Microsomal glutathione S-transferase 1-like 1
- MGST1-L1
- Microsomal prostaglandin E synthase 1
- MPGES-1
- p53-induced gene 12 protein
- Taxonomy
- Homo sapiens (Human)
- Description
-
Catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2).
- Sequence
-
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
- Active Site
-
Feature Key Position(s) Description Binding site 117 Glutathione Binding site 126 Glutathione Binding site 130 Glutathione Binding site 134 Glutathione - Structure
-
PDB:  4AL0
Show Surface - Reference
- UniProt
Covalent Inhibitors
Structure | Rank | ID | Warhead | Reaction Mechanism | Target Site | Activity Type | Relation | Value | Unit | Experiment Method | Assay | Reference |
---|